PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 195aa    MW: 21648.3 Da    PI: 4.9475
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089355.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.52e-42311311101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf  +h++FGasn++kll++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la
  XP_011089355.1  31 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTTAHRVFGASNIIKLLQELPEAQRADAVSSMVYEANARLRDPVYGCAGAICQLQNQVNELQQQLA 125
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++++
  XP_011089355.1 126 KAQAQI 131
                     **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.23830131IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4231128IPR004883Lateral organ boundaries, LOB
SuperFamilySSF1010828.89E-5107176IPR023220Type IV secretion system, VirB5-domain
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MNMEGNEVAR VSSTQTQSST SSSSAAVVMS PCAACKILRR RCVEKCVLAP YFPPTDPLKF  60
TTAHRVFGAS NIIKLLQELP EAQRADAVSS MVYEANARLR DPVYGCAGAI CQLQNQVNEL  120
QQQLAKAQAQ IANMQTQNAH LMALICDEMA QSSQTLPQHD QQSFDDFNSS PHSYQSNTSF  180
LEENNFELLW EPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089355.11e-145PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK083e-72LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A061GTD14e-90A0A061GTD1_THECC; LOB domain-containing protein 1
STRINGGLYMA13G40370.23e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-56LOB domain-containing protein 11